English version
English
 -

Abrin
Abrin agglutinin
Adenovirus, hexon
Adrenocorticotropic hormone (ACTH), human
flatoxin 1
flatoxin 2
flatoxin G2a
flatoxin M1
Aggrecan, (ARGSVILT (374-38aa) Neoepitope, human
Aggrecan, (TVK-fragment), human
Albumin, bovine (BSA)
Albumin, human (HSA)
Alcohol dehydrogenase, human
Aldo-ketoreductase, human
Alfa- 1 acid glycoprotein, bovine
Alpha-fetoprotein, human
Alkaline phosphatase, bone isophorm, human
AMACR peptide LLLNTPAIPS FKRDPFIGEH TEEILEEFGF
Aminocellulose
Aminopeptidase, human
Ampicillin
Angiostatin, human
Angiotensin I, II, III, human
Angiotensinogen, human
Argonaute 1, 2, human
Astrovirus, p40

Bacillus anthracis, lethal factor, protective antigen, spore antigen, S-layer protein
Bacteriorodopsin
bcl2, human
Biotin
BiP, human
BiP from S.cerevisiae
NT-proBNP, human
Borrelia burgdorferi garinii, OMP30
Borrelia burgdorferi sensu stricto
Bowman-Birk inhibitor (BBI)
Brucella abortus, LPS, proteins
Burkholderia mallei, LPS
Burkholderia pseudomallei, LPS

Cadherin 17, human
Calcitonin, human
Calprotectin
Campylobacter jejuni
Candida albicans, LPS
Carbendazim
Carboxypeptidase, human
Carcinoembryonic antigen (CEA), human
CD8 peptide PRPVVKSGDKPSLSARYV
Cell5a, E.coli
Chlamydia trachomatis, MOMP
Chlamydia psittaci
Chloramphenicol
Cholera toxin
CLEC 14a, mouse, human
CLDN 3, human
Clostridium Botulinum toxin A, B, C, D, E
Clostridium perfringens
Coagulation factor 8, human
Coiled-coil domain-containing protein 68 (CCD68), human
Collagenase-3 (MMP13), active, human
Collagenase-3 (proMMP13), latent, human
Complement, C3a, C4d component, human
Connexin 40, human
Corticoliberin (CRF), human
Corticosterone
Cortisol
Crimean-Congo hemorrhagic fever virus, (Puumala, Dobrava, Hanta, Seoul strains)
C-reactive protein (CRP), human
Creatine phosphokinase-BB (CK-BB), human
Cyclosporin A
Cylindrospermopsin
Cytomegalovirus, p60

a-Defensin 1, human (HD1)
a-Defensin 2, human (HD2)
a-Defensin 3, human (HD3)
a-Defensin 5, human (HD5)
a-Defensin 6, human (HD6)
Dengue virus, types 1, 2, 3, 4
Deoxinivalenol (DON)
Dermatophagoides farinae, rec. allergen 15K
Dexamethasone
Diphtheria toxin
Dobrava virus
Dopamine

Ebola virus
E. Coli H7:O157, LPS, L7/L12 ribosomal protein
Echinococcus granulosis
EpCAM, human
Epidermal growth factor (EGF), human
ErbB-2 (HER2/neu), human
ERG peptide C-PNTRLPTSHMPSH
Erysipelothrix rhusiopathiae Serotype 2, p65
Erythropoetin (EPO), human
17beta-Estradiol, human
Estriol, human
Estrogen receptor, human
Estrone, human
Equine herpes virus

Factor X, human
Fatty acids binding protein (FABP), human
Ferritin, human
Fibronectin, human
Fillagrin, human
FITC
Flagellin
Folate binding protein, human
Folic acid
Francisella tularensis, LPS
Fullerene C60
Fumonisin B1

GCSF, human
Ghrelin, human
Giardia intestinalis
Glial fibrillary acidic protein, human
Growth hormone (hGH), human
Growth hormone receptor, human

Haemagglutinin tag (HA-tag)
Haemoglobin, human
Hanta virus
Heat-shock protein, 70kDa, human (hsp70)
Heat-shock protein binding protein, human (hspBP)
Helicobacter pylori
Hemicellulose
Heparin binding protein, human
Hepatitis virus, p50
Hepatitis virus, core, eantigen, surface antigen
Hepatitis virus, NS3, NS4, NS5, core antigen
Hepsin, human
Herpes simplex virus, glycoprotein D
Histamine
Histidin6 tag
Histidin G, E.coli
Hyaluronic acid

IGFBP-I, PP12, human
Immunoglobulin A, A2, E, G1, G2, G3, G4, M, human
Immunoglobulin G, human, Fab-fragment, Fc-fragment
Immunoglobulin G, bovine
Influenza virus A, B, M2-protein, HA, NP
Infectious salmon anemia virus, putative HA
Insulin, human
Interferon-alpha 2, human
Interferon-alpha 2, feline
Interferon-beta, human
Interferon-gamma, human
Interferon-omega, feline, dog
Interleukin-2, 3, 4, 6, 17 human
Interleukin-6 receptor, human

Klebsiella pneumoniae 204

L7/L12 ribosomal protein, E.coli
Laccases, C.maxima, C.hirsuta, C.zonatus, C.fulvocinerea, St.murashkinsky
Lactoferrin, human
Lactobacillus brevis strains 20054, 6235, 1268
Legionella pneumophila, serogroup 1, 7, 11, 13 LPS
Legionella pneumophila, PL protein, PIM protein
Leucine-rich repeat-containing G-protein coupled receptor 5, human
Leukotriene B4, E4
Listeria monocytogenes
Luciferase, firefly
Lunasin
Lysozyme, human

Mannane binding protein, human
Marburg virus
Matrix metalloproteinase-3 (MMP-3), human
Matrix metalloproteinase-9 (MMP-9), equine
Metapneumovirus
Metastazin, human (MTS1, S100A4)
Methyltransferase, mouse
Microcystin-LR
Miniplasmin, human
Miniplasminogen, human
MISR (Mullerian inhibiting substance receptor type 2), human
Mistletoe lectin 1 Mycobacterium leprae, PGL-1
Mycobacterium avium, surface molecule
Mycobacterium tuberculosis, hsp70, p16, p38, hsp65, esat 6, cfp 10 MPB,
Mycobacterium tuberculosis, MPB64
Mycobacterium tuberculosis, Rv2623, Rv3134, Rv2626, Rv2031, Rv1730,Rv3130 Microcystin-LR
Myelin basic protein, human
Myoglobin, human
Myosin, heavy chain, light chain, human

N.meningitides, FetA protein
Neurone specific enolase (NSE), human
New Castle Disease virus (NDV)
Nodularin
Non-neuronal enolase (NNE), human
Nuclear factor of activated T-cells, cytoplasmic 1(NFATc1), human

Ochratoxin
Ochratoxin
Orbi virus

Pax8 peptide SSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW
p16 peptide HARIDAAEGPSDIPD
Papilloma virus, human, types 6, 11, 16, 18; E7 protein
Papilloma virus, human, types 16, 18; L1 protein
Para influenza virus, types 1, 2, 3
Parathormone (PTH), human
Parvovirus B19, VP2 protein
Parvovirus, porcine
Pdi human
Pediococcus damnosis strain 20331
Pediococcus inopinatus
Penicillin
Peptostreptococcus magnus, protein L
PII, Alfalfa chloroplasts
Plasmin, mouse
Plasmodium falciparum, MSP-1, S-antigen (Sag)
Plasmodium vivax, MSP-1, S-protein
Phospolipase A2
PMS2 peptide SSLAKRIKQLHHEAQQS
Prion protein, human, hamster, bovine
pro-BNP, human
Procalcitonin, human
Progesterone receptor, human
17alpha-OH-Progesterone
Prolin rich protein 11, human
Prostaglandin E2, F2a
8-iso Prostaglandin F2a
Prostate specific antigen (PSA), human
Prostate specific membrane membrane antigen (PSMA)
Protein M, human
Protein disulfide isomerase
Proteinkinase, cAMP-dependent regulatory subunit, human
Puumala virus <
Pyrococcus furiosus DNA polymerase (pfu)

Rabies virus, glycoprotein
Renin, human
Respiratory syncitial virus (RSV)
Revertase, wild type
Ricin, A,B-chains
Ricin agglutinin
Ricinine
Ros1, peptide NLGQQLDLGTPHNLSEPC
Rotavirus, p42
Rubella virus, glycoprotein 1, core
RunX-1, human
RunX-3, human

Salmonella virchow, serotype C
Seoul virus
Serotonin- modulated anti-consolidating protein, bovine
Serpin B3, human
Serpin B4, human
Shiga-like toxin 2
Shigella flexneri, OMP fragment
Staphylococcus aureus, lypoteichoic acid
Staphylococcus aureus enterotoxins A, B, D, E, G, I
Streptomycin
Superoxide dismutase, Cu/Zn, human
Synaptosomal-associated protein 25 (SNAP-25) Super protein

T-2 toxin
T-cell receptor, variable beta-chain, human
Tacrolimus FK 506
Tag7, human
Taq-polymerase
Testosterone
Tetanus toxin
TGF-alfa, human
THC, 11-Nor-D9-tetrahydrocannabinol-9-carbonic acid
Thermo labile toxin E.coli , LTA, LTB
Thioredoxin domain-containing protein 2 (TXNDC2), human
Thick born encephalitis virus
Threonine C, E.coli
Thymidylate synthase (TYMS), human
TIMP2, human
Toxoplasma gondii, p30
Transferrin, human
Transforming growth factor alpha (TGF-a), human
Triiodothyronine
Troponin I, cardiac, human
Troponin T, cardiac, human
Trypsinogen, human
Tumor Necrosis Factor-alpha (TNF-a), human

UCL, human
Urokinase UPA, human
Urokinase -receptor UPAR, human

Vaccinia virus, p27
Vibrio cholerae, LPS, serotypes O1, O139
Vitamin B12
von Willebrand factor, human


Yersinia pestis, F1 antigen, V antigen

Zearalenone
Zika virus, NS1 protein